To Study the Precursor Protein of Alzheimer’s Disease – Beta Amyloid.

In: Science

Submitted By ash9530327
Words 966
Pages 4
Alzheimer’s disease is a wholesale loss of synapses, contact points via which nerve cells relay signals to one another and a parallel deterioration in brain function, notably in the ability to remember. Amyloid beta (Aβ) denotes peptides of 36–43 amino acids that are crucially involved in Alzheimer's disease as the main component of the amyloid plaques found in the brains of Alzheimer patients. The peptides result from the amyloid precursor protein (APP), which is being cut by certain enzymes to yield Aβ. Study has shown that Beta amyloid begins life as a solitary molecule but tends to bunch up , initially into small clusters that are still soluble and can travel freely in the brain, and finally into the plaques that are hallmarks of Alzheimer’s. The study showed for the first time that in this clustered form, beta-amyloid can bind strongly to a receptor on nerve cells, setting in motion an intercellular process that erodes their synapses with other nerve cells.
Further looking into this protein and the information regarding it in various databases, the following was sequence was found out for the Beta amyloid A4 protein in Homo sapien in SWISSPROT.
>sp|P05067|A4_HUMAN Amyloid beta A4 protein OS=Homo sapiens GN=APP PE=1 SV=3

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET…...

Similar Documents

Alzheimer's Disease

...to Patients with Alzheimer’s Disease Megan Zann April 27, 2012 Health Psychology Dr. Ackerman Introduction It is normal to periodically forget your keys or a homework assignment, because you generally remember these things later. However, individuals who suffer from Alzheimer’s disease may forget things more often, but they do not remember them again. The incidence of Alzheimer’s disease has dramatically increased because people are living longer. This is a result of advancements in medical technology that are increasing the human life span. That being said, now there is more responsibility placed on the individual and their caregivers to provide a supportive environment to combat this disease. Alzheimer’s disease is a progressive brain disorder that causes a gradual, irreversible cognitive deterioration. The individual experiences a significant decline in their memory, language skills, perception of space and eventually, their ability to be self-sufficient and independent. Alzheimer’s disease takes a toll on the patients as well as their caregivers. “Being a caregiver for an ill or disabled loved one is widely recognized as a threat to caregiver’s quality of life” (Poulin et al 2010). The diagnosis of this disease affects the caregivers on physical, psychological, and social levels. Family, friends, and caregivers suffer from pain and stress as they witness their loved one experiencing the progression of the disease. Background “Alzheimer’s disease is the most......

Words: 3180 - Pages: 13

Alzheimer's Disease

...Alzheimer’s disease HCA/240 Veronica Brinson Mary Lou. Jenkins August 25, 2013   Alzheimer’s disease is a chronic progressive deterioration of the brain leading to dementia, incapacitation, and death. Dementia is a condition marked by memory loss plus a minimum of one other cognitive impairment. Alzheimer’s disease has been referred to as both the plaque of the ages and the plague of the aged. Alzheimer’s disease was so poorly understood that people who suffered this dementia were label as tormented, affected, pixilated, weird, afflicted, senile, mad, crazy, and spellbound. People with Alzheimer disease were feared, avoided, ignored, and ridiculed. Years and years went by peoples suffered terrible inhuman treatment when their families hid them away from other family members, the public, restrained them at home, locked them up in rooms, and committed them to insane asylums. There are many symptoms follow a set course of decline. There are a wide spectrum of demented actions every person will exhibit every symptom is a downhill regression follow a general pattern of mental regression and physical decline. People with the Alzheimer’s disease the earlier symptoms are recognized the greater chances are to slow and prevent the progression of dementia. Symptoms of Alzheimer’s disease are short-term memory loss, confusion, disorientation, wandering, mood swing, sundowner’s syndrome, eating habits and weight loss(changes) personal care, depression,......

Words: 946 - Pages: 4

Alzheimer's Disease; a Disease Without a Cure

...Final Research Paper Ryan Hermes Health 106 SP 13 “Alzheimer’s Disease; A Disease Without A Cure” Alzheimer’s disease, otherwise known as dementia, is a genetic disease that causes the brain to deteriorate until death. Currently, there is no cure for Alzheimer’s disease, and once the diagnosis is given the disease only gets worse. The disease isn’t very well understood, however researchers are working to help treat the symptoms of the disease. With all of the advancements in medicine there are no treatments available to stop or reverse the progression of Alzheimer’s disease. In 1901 a German psychiatrist named Alois Alzheimer’s documented the first recorded case of Alzheimer’s disease. He studied a woman named Auguste Deter, she was a woman in her fifties who had severe early onset Alzheimer’s disease, and she died in 1906. After her death, Alzheimer’s worked with two Italian physicians on staining techniques to study Auguste’s brain. He noted certain plaques that infiltrated her brain, however technology could only go so far at the time so the results of the brain examination were speculative. Alzheimer’s disease affects the brain in a way that causes its victims to lose some or most of their memory. This causes the patient to forget things such as who they are, who their relatives are, where they are, how to get home, or even when or how to eat. These problems make caring for the patient difficult because the care person has to do almost......

Words: 1522 - Pages: 7

Neurodegenerative Disorders: Alzheimer’s Disease

...Neurodegenerative Disorders: Alzheimer’s Disease 1. Amyloid Precursor Protein (APP) Alzheimer’s disease (AD) remains a major cause of senile dementia, which is characterised by an impairment of neuronal and synaptic function in addition to the accumulation of β-amyloid plaque and formation of neurofibrillary tangles within distinct portions of the brain (De Strooper and Annaert, 2000). Progression of this distinct pathology of neurodegeneration does not typically vary from patient to patient, beginning in cerebral cortex before targeting the hippocampus, neocortex as well as the sub-cortical nuclei (Braak and Braak, 1995). The role of amyloid precursor protein (APP) in the pathogenesis of Alzheimer’s disease is pivotal. The cleavage of APP by the proteases β and γ- secretase releases β-amyloid (Aβ) peptides which results in aggregation of the peptides due to misfolding to form fibrils of Aβ which comprise the key components of amyloid plaque deposits in the brains of AD patients (Glenner and Wong, 1984). Amyloid precursor protein (APP) is a trans-membrane glycoprotein which normally functions in synapse formation as well as axonal elongation. The protein possesses a small cytoplasmic domain but is composed primarily of a large extracellular domain. Processing of APP in the extracellular domain by α or β- secretase results in the complete removal of the protein’s ectodomain which gives rise to an accumulation of sizeable and soluble derivatives of APP referred to......

Words: 2251 - Pages: 10

Alzheimer's

...The Study Of Alzheimer’s What exactly is Alzheimer’s disease? Alzheimer’s disease is a disorder that occurs in the brain in which specific brain cells degenerate, causing memory loss, and impairs thinking and behavior. It usually develops in people in their 60’s or early 70”s, and approximately 4 million Americans suffer from this disease and 100 million die each year. The risk factors for developing Alzheimer’s disease: There are 3 genes when mutated that cause Alzheimer’s disease. * APP gene (amyloid precursor protein) (chromosome 21) is expressed in the synapse and is thought to be responsible for forming and repairing synapses. Mutations of the APP gene have been associated with Alzheimer ’s disease and with early onset in particular. A primary cause of Alzheimer’s disease is deposits of a protein called amyloid-beta as plaques in the brain. Beta amyloid is released following cleavage of APP at a number of points, and mutations can lead to an increase in production of protein. More than 20 mutations of the APP gene haven been and cause early onset of Alzheimer’s disease. * Presenilin 1 gene (chromosome 14) and Presenilin 2 gene ( chromosome 19) are proteins that span the cell membrane and are primarily expressed in neurons. They also determine secretase activity, which is responsible for cleaving the amyloid precursor protein (APP). In sum APP cleavage can produce amyloid-beta, which is the primary component of plaques in the brains of Alzheimer......

Words: 480 - Pages: 2

Alzheimer's Disease and Its Link to the Normal Human Developmental Process of Aging

...Alzheimer's Disease and its Link to the Normal Human Developmental Process of Aging Angel M. Perez Liberty University Abstract The cause of Alzheimer’s disease (AD) is currently unknown. However, extensive studies using new technology has led to new ways of accurately identifying AD, an understanding of the mechanisms involved regarding the development of AD, and the damage it causes in the human brain. The general population is under the impression that AD is a result of the normal human developmental process of aging. The focus of this research is to dismiss this misconception by providing indisputable empirical evidence to the contrary. This paper looks at the various studies explored by researchers in an attempt to show the factors attributed to AD, a population over the age of 65 that do not suffer from AD, and a population of as young as 18 clinically diagnosed with Alzheimer's disease. The author also addresses life style, environmental, and genetic risk factors attributed to the development of AD. Alzheimer's Disease and its Link to the Normal Human Developmental Process of Aging Contrary to popular belief, studies show that Alzheimer’s disease is not part of the normal human developmental process of aging. It is imperative that researchers acknowledge that AD is not part of the normal aging process. Researchers must keep an open mind during the research and experimental process, exploring all plausible arguments, in order to discover the cause(s)......

Words: 5079 - Pages: 21

Human Ageing Alzheimer's Disease

...Mark Ocampo BIOL 384N Human Aging ALZHEIMER’S DISEASE We often associate Alzheimer’s disease with the aging process, but is it safe to assume that? From my perspective and possibly others I believe that memory loss is natural with aging, but no to the severity a person with the disease would experience. First of all, what is this disease that creates so much havoc? Well, Alzheimer’s disease is a neurological disorder in which death of a brain cell occurs. Expectations from loss of brain cells can be mental deterioration such as memory loss, cognitive decline and eventually, death. Cognitive thinking can be skills such as attention, working memory, process speed, long term memory, visual processing, auditory processing and logic and reasoning. Though there are numerous research on this disease specific reasons have not been found, but two prime suspects are tangles and plaques which are found in the hippocampus. Tangles are found in dead and dying nerve cells. They are made of collapsed protein that twists into strands that we call tangles. The proteins are called tau. Tau is normally associated with the transport systems. The transport system is like the railroad tracks in our bodies where food molecules, cell parts and other key materials travel. Normally, Tau keeps the transport system on track by helping it stay straight ,but where tangles are formed the tau are no longer able to keep the track straight. Thus, the transport systems fall apart and disintegrate. ......

Words: 713 - Pages: 3

Analysis of Alzheimer’s Disease Based on the D.N. Case Study.

...Analysis of Alzheimer’s Disease based on the D.N. case study. D.N. developed Alzheimer’s disease at age 50. Early signs were vague and included occasional errors in judgment and increased criticism of others, noted only in retrospect. Several years later, following several episodes of extreme anger, a diagnosis of Alzheimer was made. At this time, it was suspected that his father also had AD but had died from an unrelated cause before the diagnosis was could be made […] The neurologist prescribed gelantamine, an anticholinesterase inhibitors and regular attendance at a group center offering appropriate activities […] The degeneration progresses rapidly over the next 2 years. The maximum dose of galantamine is no longer effective. He is confused about any change and not capable of performing simple activities. Communication is impaired, including that with family members […] (Gould, Dyer, 2010 p.527) Although aging is a natural part of human existence, it is also considered the most difficult phase of ones life. Social, psychological and financial factors may remind a person that the quality of their every day is not what it used to be, but the physical changes that take place in the human body are the ones that affect aged people the most. Among a long list of conditions and diseases that are prevalent in the elderly population, forms of dementia are the ones that not only lead to unavoidable health impairment......

Words: 1212 - Pages: 5

Alzheimer's Disease

...http://www.alz.org/alzheimers_disease_what_is_alzheimers.asp ALZHEIMER’S DISEASE * Alzheimer's is the most common form of dementia, a general term for memory loss and other intellectual abilities serious enough to interfere with daily life. Alzheimer's disease accounts for 60 to 80 percent of dementia cases.  Bottom of Form * Alzheimer's is not a normal part of aging, although the greatest known risk factor is increasing age, and the majority of people with Alzheimer's are 65 and older. But Alzheimer's is not just a disease of old age. Up to 5 percent of people with the disease have early onset Alzheimer's (also known as younger-onset), which often appears when someone is in their 40s or 50s. * Alzheimer's worsens over time. Alzheimer's is a progressive disease, where dementia symptoms gradually worsen over a number of years. In its early stages, memory loss is mild, but with late-stage Alzheimer's, individuals lose the ability to carry on a conversation and respond to their environment. Alzheimer's is the sixth leading cause of death in the United States. Those with Alzheimer's live an average of eight years after their symptoms become noticeable to others, but survival can range from four to 20 years, depending on age and other health conditions.  * Alzheimer's has no current cure, but treatments for symptoms are available and research continues. Although current Alzheimer's treatments cannot stop Alzheimer's from progressing, they can temporarily slow the......

Words: 6877 - Pages: 28

Alzheimer’s Disease

...Alzheimer’s Disease Michael A. Smith HCS/245 May 26, 2014 Dr. Michelle Clemons Alzheimer’s Disease Alzheimer is a stage of dementia which ability of the brain appears to stop functioning, such as creating memory loss, judgment instability, lack emotions with reasoning and changes in behavior. This is found more common in the elderly population of people. Studies shows apparently some people over sixty-five develops forms of dementia with the increase in later years after eighty-five. The Alzheimer's disease can be found in millions of Americans and more prevalent amongst African-Americans than other races. Describing the disease This type if disease very complex and changing rapidly without much discovery concerning treatments. When the processing of some proteins experiences interference or goes wrong terribly, the development of Alzheimer disease starts to blossom. This activity caused the brain cells with space between them cluttered with toxic protein; resulting loss nerve cells in regions of the brain upon investigation by microscopes for clear venture would reveal it. Such clusters are of two forms: the ones found between cells and those inside nerve cells. The dying nerve cells communicate with neurotransmitter acetylcholine a compound that would break down an enzyme known as acetyl cholinesterase and other studies now suggests having high cholesterol and also blood pressure being too high can be contributing toward Alzheimer disease......

Words: 1097 - Pages: 5

Alzheimer's Disease

...Amanda Farrington Research paper October 17, 2014 Despite the forgetfulness, we have of the seriousness of Alzheimer’s disease; the behind the scenes action is what we need to be taking a look at. Researcher is now choosing different routes of prevention, treatment and diagnostic studies to solve this serious illness. Which different stages of diagnosis it’s difficult to find the target of what triggers the disease. With the majority of patients being diagnosed being of the elderly stage of life, testing different options is risky because of old age. As many years and millions have gone on to find the cure to stop this tragic illness that overcomes thousands of loved ones every year, scientist have decided to step back and make a strategy. With so many failed attempts of curing this disease, they decided to find an attack approach before being diagnosed. Studies have gone into the smallest detail to find common traits that those diagnosed have. While this is an endless and tedious process, they continued. Scientist have discovered that there are ways to lower the risks of being diagnosed with the disease in the future. Although there is no cure once diagnosed, there have been studies found on how to lessen your chances of getting it. Multiple articles, including National Institute of Agings “alheimer’s prevention”, state that vitamins are always a natural and healthy route as well as anti inflammatory drugs. While a healthy diet and exercise can be effective...

Words: 1637 - Pages: 7

Alzheimer’s Disease a Fight for Information and Understanding

...Alzheimer’s Disease a Fight for Information and Understanding ABSTRACT Alzheimer’s disease slowly deteriorates the brain, causing loss of both memory and the ability to control emotion. This review will discuss possible indicators, hypothesized causes, and both current and experimental treatments of Alzheimer’s. The disease mostly affects people over the age of 60 but can occur earlier. The problem with detecting Alzheimer’s early is that there are no clear indicators, and the changes in the brain progress before symptoms in the patient are visible. It’s hypothesized that the main cause of Alzheimer’s is neuronal plasticity and a build up of plaques. The plasticity leads to neuron tangles, causing blocks in synaptic signaling. Research on assays for detecting amyloid-beta ligands and disease treatments will need to involve human trails for future investigation. KEY WORDS: Alzheimer’s disease, neuronal plasticity, Tau-directed Therapy, amyloid-beta ligands, dementia INTRODUCTION Alzheimer’s disease (AD) is a deteriorating disease of the brain that attacks neurons throughout the cerebral cortex and the hippocampus.1,2 The deterioration the cerebral cortex leads to the impairment of a person’s ability to control emotion, coordination, and the ability to comprehend configurations.6 The loss of memory caused by AD comes from the deterioration of the hippocampus.5 Alzheimer’s is most common in people 65 years or older, however for people with early onset......

Words: 2763 - Pages: 12

Alzheimer's Disease

...Alzheimer's Disease Introduction to Alzheimer's Alzheimer's disease is a progressive degenerative disease of the brain. It is first described by the German neuropathologist Alois Alzheimer (1864-1915) in 1905. This disease worsens with advancing age, although there is no evidence that it is cause by the aging process. The average life expectancy of a person with the disease is between five and ten years, but some patients today can live up to 15 years due to improvements in care and medical treatments. The cause of Alzheimer's has not been discovered yet and it cannot be possible to confirm a person has Alzheimer's until their autopsy following death. How does Alzheimer's develop What causes Alzheimer's? Well no one know exactly the development of this debilitating disease. But recent advances has produced several clues as to how it is born. Initially when we study the brain of a Alzheimer's victim, we focus on two specific areas. One is the cortex of the frontal and cerebral lobes1. The second is the hippocampus (meaning seahorses in Greek which it resembles2) which is located below the cerebral cortex and responsible for short-term memory. If we study samples of these two section, we would find three irregularities which are not found in normal brain matter. These three are called neurofibrillary tangles, neuritic plagues and granulovacuolar degeneration3. A nerve cell has numerous axons and dendrites coming......

Words: 1279 - Pages: 6

Alzheimer's Disease

...Alzheimer’s Disease Alzheimer’s disease, or simply known as Alzheimer’s, is kind of disease that affects the brain. Alzheimer’s is a type progressive disease, which means that the disease will gradually worsen over time. Alzheimer’s is the most common form of dementia, which is a term used to describe a brain disorder that causes the loss of memory and other intellectual skills such as thinking skills, problem-solving, language and social skills. Cause of Alzheimer’s Disease Alzheimer’s brain tissues tend to have less nerve cells and synapses as they are destroyed by plagues and tangles. Plagues are clusters of protein fragments called beta-amyloid that are built up between the nerve cells. Tangles are made up of twisted strands of protein called tau. Beta-amyloid is a fragment of a protein found in the neuron’s cell membrane called amyloid precursor protein (APP). APP is a transmembrane protein, which means the APP molecule passes through the cell membrane of neuron. In order for beta-amyloid to be released from the APP molecule, two enzymes must be involved which are beta-secretase and gamma-secretase. First, beta-secretase cut the peptide chain of APP outside the cell membrane at a certain length. Then the gamma-secretase makes a cut inside the membrane, releasing the beta-amyloid. The beta-amyloid released will be in two forms, one which has 40 amino acids and another one with 42 amino acids. The beta-amyloid peptide with 42 amino acids is the one that will......

Words: 815 - Pages: 4

Pet Imaging and Alzheimer's Disease

...Alzheimer’s Disease is an irreversible, degenerative brain disease that is marked by the build up of plaque and tangles in the neurons of Alzheimer’s patients, which induce memory loss and inhibit mental functions. Estimates vary, but experts believe as many as 5.1 million Americans are currently suffering from Alzheimer’s (Alzheimer’s Fact Sheet). Although there is no cure for the disease, early detection of Alzheimer’s is crucial because it allows the patient to immediately begin a drug regimen that slows the process of the disease. In modern medicine, two types of PET imaging, fluorodeoxyglucose and amyloid, are the most effective methods of diagnosing Alzheimer’s Disease. The degenerative aspect of Alzheimer’s is caused by plaque and tangles in the nerve cells of the brain. Abnormal clusters of protein fragments called beta amyloid accumulate in the synaptic gap between neurons and block cell-to-cell signaling (Alzheimer’s Association). This build up of plaque may also activate an autoimmune response, which kills the deactivated cells (Medicine Net). Simultaneously, tangles in a protein called tau destroy a vital nerve cell transport system. Healthy transport systems are kept orderly and parallel by tau (Alzheimer’s Association). In Alzheimer’s patients, however, tau collapses in to twisted strands called tangles. The transport system can no longer stay parallel, which causes it to disintegrate. Key materials like food molecules and cell parts can no longer move through...

Words: 1957 - Pages: 8